Record in detail


General Info

  • lamp_id:L01A000901
  • Name:Sequence 47 from patent US 7166769
  • FullName:Sequence 47 from patent US 7166769
  • Source:Synthetic
  • Mass:10019.7 Da
  • Sequence Length:94 aa
  • Isoelectric Point:8.83
  • Activity:Antimicrobial
  • Sequence
        MKKLRTTTLALLLLLVFLAASSLRAAMAGSAFCDGKCGVRCSKASRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHGARKRPKCP
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000901    From 1 To 94 E-value: 0 Score: 188
        MKKLRTTTLALLLLLVFLAASSLRAAMAGSAFCDGKCGVRCSKASRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHGARKRPKCP
  • 2. L01A000900    From 25 To 98 E-value: 8e-37 Score: 144
        TSLRVAMAGSAFCDSKCGVRCSKAGRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHGARTRPKCP
  • 3. L01A001074    From 23 To 93 E-value: 8e-34 Score: 134
        QVSMAGSDFCDGKCKVRCSKASRHDDCLKYCGVCCASCNCVPSGTAGNKDECPCYRDMTTGHGARKRPKCP
  • 4. L01A000909    From 25 To 95 E-value: 8e-34 Score: 134
        RVSMAGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTGHGNRTRPKCP
  • 5. L01A000859    From 1 To 59 E-value: 2e-28 Score: 115
        CDGKCKVRCSKASRHDDCLKYCGVCCASCNCVPSGTAGNKDECPCYRDMTTGHGARKRP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: