Record in detail


General Info

  • lamp_id:L01A000997
  • Name:Sequence 18 from patent US 7071293
  • FullName:Sequence 18 from patent US 7071293
  • Source:Synthetic
  • Mass:4433.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:12.11
  • Activity:Antimicrobial
  • Sequence
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1058
  •   2  Database:AMD  C18_RABIT

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000997    From 1 To 37 E-value: 0.000000000000006 Score: 71.2
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
  • 2. L11A011783    From 1 To 37 E-value: 0.00000000000001 Score: 70.1
        GLRKRLRKFRNKMKEKLKKIGQKIQGLLPKLAPRTDY
  • 3. L11A013098    From 1 To 37 E-value: 0.00000000000001 Score: 70.1
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKCAPRTDY
  • 4. L11A013086    From 1 To 37 E-value: 0.00000000000001 Score: 70.1
        GLRKRLRKFRNKIKEKCKKIGQKIQGLLPKLAPRTDY
  • 5. L11A013094    From 1 To 37 E-value: 0.00000000000002 Score: 69.7
        GLRKRLRKFRNKIKEKLKKIGQKCQGLLPKLAPRTDY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: