Record in detail


General Info

  • lamp_id:L01A001010
  • Name:Sequence 6 from patent US 6911524
  • FullName:Sequence 6 from patent US 6911524
  • Source:Synthetic
  • Mass:4446.2 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.42
  • Activity:Antimicrobial
  • Sequence
        HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001013    From 21 To 60 E-value: 4e-20 Score: 88.2
        HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
  • 2. L01A001010    From 1 To 40 E-value: 3e-18 Score: 82.4
        HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
  • 3. L12A07614|    From 21 To 60 E-value: 4e-17 Score: 78.6
        HSHACASYYCSKFCGTASCTHYLCRVLHPGKLCACVNCSR
  • 4. L12A07618|    From 21 To 60 E-value: 6e-17 Score: 77.8
        HSHACTSYYCAKFCGTASCTHYLCRVLHPGKLCVCVNCSK
  • 5. L12A07615|    From 21 To 60 E-value: 1e-16 Score: 77
        HSHACASYYCSKFCGTASCTHYLCRVLHPGKLCVCVNCSR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: