Record in detail


General Info

  • lamp_id:L01A001011
  • Name:Sequence 5 from patent US 6911524
  • FullName:Sequence 5 from patent US 6911524
  • Source:Synthetic
  • Mass:3894.4 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.41
  • Activity:Antimicrobial
  • Sequence
        HXHXCTSYXCXKFCGTAXCTXYXCRXLHXGKXCXCXHCSR
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001013    From 21 To 60 E-value: 0.00000000005 Score: 58.2
        HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
  • 2. L01A001012    From 21 To 60 E-value: 0.0000000002 Score: 56.2
        HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR
  • 3. L12A07613|    From 21 To 60 E-value: 0.0000000002 Score: 56.2
        HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR
  • 4. L12A07619|    From 21 To 60 E-value: 0.0000000002 Score: 55.8
        HSHACTSYYCSKFCGTASCTHYLCRVLHPGKLCVCANCSR
  • 5. L12A07618|    From 21 To 60 E-value: 0.0000000006 Score: 54.7
        HSHACTSYYCAKFCGTASCTHYLCRVLHPGKLCVCVNCSK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: