Record in detail


General Info

  • lamp_id:L01A001113
  • Name:Sequence 7 from patent US 6872705
  • FullName:Sequence 7 from patent US 6872705
  • Source:Synthetic
  • Mass:4243.1 Da
  • Sequence Length:38 aa
  • Isoelectric Point:12.63
  • Activity:Antimicrobial
  • Sequence
        MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:SATPdb  satpdb20061

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001113    From 1 To 38 E-value: 5e-16 Score: 74.7
        MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG
  • 2. L13A011753    From 1 To 38 E-value: 0.000000000000001 Score: 73.6
        MPRYRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG
  • 3. L12A08746|    From 26 To 62 E-value: 0.0000000004 Score: 55.1
        PRWKVFKKIEKVGRNIRDGILKAGPAIAVLGEAKALG
  • 4. L13A022492    From 1 To 38 E-value: 0.0000000005 Score: 55.1
        MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG
  • 5. L03A000216    From 26 To 62 E-value: 0.000000001 Score: 53.5
        PRWKVFKKIEKVGRNIRDGVIKAGPAIAVVGQAKALG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: