Record in detail


General Info

  • lamp_id:L01A001114
  • Name:Sequence 6 from patent US 6872705
  • FullName:Sequence 6 from patent US 6872705
  • Source:Synthetic
  • Mass:3892.7 Da
  • Sequence Length:36 aa
  • Isoelectric Point:11.49
  • Activity:Antimicrobial
  • Sequence
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000213    From 27 To 62 E-value: 0.000000000000004 Score: 72
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG
  • 2. L01A001114    From 1 To 36 E-value: 0.00000000000001 Score: 70.1
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG
  • 3. L01A000064    From 1 To 35 E-value: 0.00000000000005 Score: 68.2
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
  • 4. L13A022492    From 3 To 38 E-value: 0.00000000000005 Score: 68.2
        KWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG
  • 5. L12A08751|    From 27 To 62 E-value: 0.00000000000005 Score: 68.2
        RWKVFKKIEKMGRNVRDGIIKAGPAIAVLGEAKALG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: