Record in detail


General Info

  • lamp_id:L01A001233
  • Name:Sequence 23 from patent US 6818407
  • FullName:Sequence 23 from patent US 6818407
  • Source:Synthetic
  • Mass:3398 Da
  • Sequence Length:33 aa
  • Isoelectric Point:10.8
  • Activity:Antimicrobial
  • Sequence
        ALWKTMLKKLGTMALHAGKAALGAAADTISQTQ
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001233    From 1 To 33 E-value: 0.000000000001 Score: 63.5
        ALWKTMLKKLGTMALHAGKAALGAAADTISQTQ
  • 2. L11A012112    From 1 To 31 E-value: 0.0000000001 Score: 57
        ALWKTMLKKLGTVALHAGKAALGAVADTISQ
  • 3. L12A06611|    From 45 To 75 E-value: 0.000000001 Score: 53.1
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 4. L12A06182|    From 45 To 75 E-value: 0.000000002 Score: 53.1
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 5. L02A000956    From 1 To 31 E-value: 0.000000002 Score: 53.1
        ALWKDVLKKIGTVALHAGKAALGAVADTISQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: