Record in detail


General Info

  • lamp_id:L01A001241
  • Name:Sequence 11 from patent US 6818407
  • FullName:Sequence 11 from patent US 6818407
  • Source:Synthetic
  • Mass:3322.2 Da
  • Sequence Length:30 aa
  • Isoelectric Point:11.71
  • Activity:Antimicrobial
  • Sequence
        KWKKFIKKIGIGAVLKVLTTGLPALKLTKK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001241    From 1 To 30 E-value: 0.0000000004 Score: 55.1
        KWKKFIKKIGIGAVLKVLTTGLPALKLTKK
  • 2. L01A001140    From 1 To 28 E-value: 0.0000004 Score: 45.1
        KWKLF-KKIGIGAVLKVLTTGLPALKLTK
  • 3. L13A010172    From 1 To 29 E-value: 0.0000009 Score: 43.9
        KWKLF-KKIGIGAVLKVLTTGLPALKLTLK
  • 4. L13A012184    From 3 To 29 E-value: 0.000001 Score: 43.9
        WKLF-KKIGIGAVLKVLTTGLPALKLTK
  • 5. L13A016510    From 1 To 26 E-value: 0.000001 Score: 43.9
        KLFKKIGIGAVLKVLTTGLPALKLTK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: