Record in detail


General Info

  • lamp_id:L01A001243
  • Name:Sequence 9 from patent US 6818407
  • FullName:Sequence 9 from patent US 6818407
  • Source:Synthetic
  • Mass:3632.7 Da
  • Sequence Length:33 aa
  • Isoelectric Point:11.65
  • Activity:Antimicrobial
  • Sequence
        KLWKLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001243    From 1 To 33 E-value: 0.00000000003 Score: 58.9
        KLWKLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 2. L01A001246    From 2 To 32 E-value: 0.0000000002 Score: 56.2
        WKLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 3. L01A001245    From 1 To 30 E-value: 0.000000002 Score: 53.1
        KLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 4. L01A001244    From 2 To 31 E-value: 0.00000001 Score: 50.4
        WK-FKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 5. L11A000178    From 1 To 30 E-value: 0.00000002 Score: 49.3
        KLWKLFKKIGIGA---VLKVLTTGLPALKLTLK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: