Record in detail


General Info

  • lamp_id:L01A001246
  • Name:Sequence 6 from patent US 6818407
  • FullName:Sequence 6 from patent US 6818407
  • Source:Synthetic
  • Mass:3519.5 Da
  • Sequence Length:32 aa
  • Isoelectric Point:11.65
  • Activity:Antimicrobial
  • Sequence
        KWKLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001246    From 1 To 32 E-value: 0.00000000007 Score: 57.8
        KWKLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 2. L01A001243    From 3 To 33 E-value: 0.0000000002 Score: 56.2
        WKLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 3. L01A001245    From 1 To 30 E-value: 0.000000002 Score: 53.1
        KLFKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 4. L01A001244    From 1 To 31 E-value: 0.000000004 Score: 52
        KWK-FKKIGIGAVLKVLKVLTTGLPALKLTLK
  • 5. L13A010172    From 1 To 29 E-value: 0.00000005 Score: 48.1
        KWKLFKKIGIGA---VLKVLTTGLPALKLTLK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: