Record in detail


General Info

  • lamp_id:L01A001251
  • Name:Sequence 4 from patent US 6753407
  • FullName:Sequence 4 from patent US 6753407
  • Source:Synthetic
  • Mass:5184.8 Da
  • Sequence Length:44 aa
  • Isoelectric Point:11.76
  • Activity:Antimicrobial
  • Sequence
        FFRHLFRGAKAIFRGARQGXRAHKVVSRYRNRDVPETDNNQEEP
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07790|    From 23 To 66 E-value: 6e-21 Score: 91.3
        FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP
  • 2. L02A001377    From 1 To 44 E-value: 2e-20 Score: 89.7
        FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP
  • 3. L01A001251    From 1 To 44 E-value: 2e-20 Score: 89.4
        FFRHLFRGAKAIFRGARQGXRAHKVVSRYRNRDVPETDNNQEEP
  • 4. L12A07791|    From 27 To 56 E-value: 0.000000009 Score: 50.8
        LFRGAKAIFRGARQGWRSHKAVSRYRARYV
  • 5. L12A05777|    From 5 To 34 E-value: 0.00000001 Score: 50.1
        LFRGAKAIFRGARQGWRSHKAVSRYRARYV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: