Record in detail


General Info

  • lamp_id:L01A001361
  • Name:Sequence 296 from patent US 6727066
  • FullName:Sequence 296 from patent US 6727066
  • Source:Synthetic
  • Mass:7419.6 Da
  • Sequence Length:68 aa
  • Isoelectric Point:8.7
  • Activity:Antimicrobial
  • Sequence
        MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001361    From 1 To 68 E-value: 3e-35 Score: 139
        MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • 2. L03A000291    From 1 To 68 E-value: 9e-28 Score: 113
        MRTSYLLLFTLCLLLSEIASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYGGKAKCCK
  • 3. L03A000296    From 1 To 68 E-value: 2e-27 Score: 112
        MRTSYLLLFTLCLLMSEMASGDNFLTGLGHRSDHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK
  • 4. L03A000294    From 1 To 68 E-value: 4e-27 Score: 111
        MRTSYLLLFTLCLLLSEMASGDNFLTGLGHRSDHYNCVRSGGQCLYSACPIYTKIQGTCYQGKAKCCK
  • 5. L03A000293    From 1 To 68 E-value: 7e-27 Score: 110
        MRTSYLLLFTLCLLLSEMASGDNFLTGLGHRSDHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: