Record in detail


General Info

  • lamp_id:L01A001369
  • Name:Sequence 85 from patent US 6696238
  • FullName:Sequence 85 from patent US 6696238
  • Source:Synthetic
  • Mass:7037.6 Da
  • Sequence Length:64 aa
  • Isoelectric Point:9.51
  • Activity:Antimicrobial
  • Sequence
        MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001369    From 1 To 64 E-value: 5e-32 Score: 127
        MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 2. L03A000299    From 1 To 64 E-value: 1e-31 Score: 126
        MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 3. L01A001370    From 1 To 64 E-value: 2e-31 Score: 126
        MRVLYLLFSFLFIFLMPLPGVFGGISDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 4. L03A000300    From 1 To 64 E-value: 3e-29 Score: 118
        MRVLYLLFSFPFIFLMPLPGVFGDIRNPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCRKP
  • 5. L03A000298    From 1 To 64 E-value: 2e-22 Score: 96.3
        MRVLYLLFSFLFIFLMPLPGVFGDIRNPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCRKP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: