Record in detail


General Info

  • lamp_id:L01A001371
  • Name:Sequence 1 from patent US 6696238
  • FullName:Sequence 1 from patent US 6696238
  • Source:Synthetic
  • Mass:7041.4 Da
  • Sequence Length:64 aa
  • Isoelectric Point:11.78
  • Activity:Antimicrobial
  • Sequence
        MRLHHLLLALLFLVLSAGSGFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001371    From 1 To 64 E-value: 5e-32 Score: 128
        MRLHHLLLALLFLVLSAGSGFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 2. L02A000401    From 1 To 45 E-value: 2e-21 Score: 92.4
        GFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 3. L01A001519    From 1 To 44 E-value: 9e-21 Score: 90.5
        FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 4. L03A000068    From 1 To 55 E-value: 2e-20 Score: 89.7
        LALLFLVLSAGSGFTQGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR
  • 5. L03A000069    From 1 To 55 E-value: 2e-20 Score: 89.4
        LALLFLVLSAGSGFTQGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: