Record in detail


General Info

  • lamp_id:L01A001447
  • Name:Sequence 30 from patent US 6399370
  • FullName:Sequence 30 from patent US 6399370
  • Source:Synthetic
  • Mass:6953.5 Da
  • Sequence Length:64 aa
  • Isoelectric Point:10.94
  • Activity:Antimicrobial
  • Sequence
        MRLHHLLLALLFLVLSAWSGFTQGVGNPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001447    From 1 To 64 E-value: 1e-32 Score: 129
        MRLHHLLLALLFLVLSAWSGFTQGVGNPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
  • 2. L12A09081|    From 1 To 64 E-value: 1e-22 Score: 96.7
        MRLHHLLLALLFLVLSAWSGFTQGVGNPLSCGRNKGICVPIRCPGKMKQIGTCVGRAVKCCRKK
  • 3. L01A001371    From 1 To 64 E-value: 8e-18 Score: 80.9
        MRLHHLLLALLFLVLSAGSGFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 4. L03A000069    From 1 To 56 E-value: 2e-17 Score: 79.3
        LALLFLVLSAGSGFTQGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRS
  • 5. L12A09074|    From 1 To 62 E-value: 3e-17 Score: 79
        MRLHHLLLALLFLVLSAGSGFTQGISNPLSCRRNKGICLPIRCPGSMRQIGTCFGPRVKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: