Record in detail


General Info

  • lamp_id:L01A001450
  • Name:Sequence 4 from patent US 6399370
  • FullName:Sequence 4 from patent US 6399370
  • Source:Synthetic
  • Mass:3934.5 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.61
  • Activity:Antimicrobial,Anticancer
  • Sequence
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001361    From 33 To 68 E-value: 5e-17 Score: 78.2
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • 2. L07APD0033    From 8 To 43 E-value: 2e-16 Score: 76.3
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • 3. L01A001450    From 1 To 36 E-value: 2e-16 Score: 75.9
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • 4. L12A01066|    From 1 To 36 E-value: 4e-16 Score: 75.1
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGEAKCCK
  • 5. L12A01061|    From 1 To 36 E-value: 4e-16 Score: 75.1
        DHYNCVSSGGQCLYSACPIFTEIQGTCYRGKAKCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: