Record in detail


General Info

  • lamp_id:L01A001474
  • Name:Sequence 1 from patent US 6211148
  • FullName:Sequence 1 from patent US 6211148
  • Source:Synthetic
  • Mass:4263 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.4
  • Activity:Antimicrobial
  • Sequence
        DFASCHTNGGICLPNRCPGHMIQIGICFRPRVLCCRSW
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001474    From 1 To 38 E-value: 5e-18 Score: 81.3
        DFASCHTNGGICLPNRCPGHMIQIGICFRPRVLCCRSW
  • 2. L12A09086|    From 27 To 64 E-value: 8e-18 Score: 80.9
        DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW
  • 3. L01A000362    From 1 To 38 E-value: 2e-17 Score: 79.3
        DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW
  • 4. L12A09074|    From 30 To 64 E-value: 0.0000000007 Score: 54.3
        SCRRNKGICLPIRCPGSMRQIGTCFGPRVKCCRSW
  • 5. L12A02358|    From 10 To 44 E-value: 0.0000000009 Score: 53.9
        SCSRNKGICLPIRCPGSMRQIGTCFGPRVKCCRSW

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: