Record in detail


General Info

  • lamp_id:L01A001515
  • Name:Sequence 1 from patent US 5905187
  • FullName:Sequence 1 from patent US 5905187
  • Source:Synthetic
  • Mass:4187.7 Da
  • Sequence Length:34 aa
  • Isoelectric Point:11.85
  • Activity:Antimicrobial
  • Sequence
        RSGRGECRRQCLRRHEGQPWETQECMRRCRRRGG
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001515    From 1 To 34 E-value: 0.0000000000003 Score: 65.5
        RSGRGECRRQCLRRHEGQPWETQECMRRCRRRGG
  • 2. L12A02468|    From 11 To 43 E-value: 0.0000000000004 Score: 65.1
        RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG
  • 3. L01A000123    From 1 To 33 E-value: 0.000000000001 Score: 63.5
        RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG
  • 4. L13A012134    From 1 To 33 E-value: 0.0000002 Score: 46.6
        SGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRG
  • 5. L02A001760    From 2 To 34 E-value: 0.0000002 Score: 46.2
        SGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: