Record in detail


General Info

  • lamp_id:L01A001519
  • Name:Sequence 8 from patent US 5849490
  • FullName:Sequence 8 from patent US 5849490
  • Source:Synthetic
  • Mass:4897.8 Da
  • Sequence Length:44 aa
  • Isoelectric Point:11.44
  • Activity:Antimicrobial
  • Sequence
        FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001371    From 21 To 64 E-value: 1e-20 Score: 90.5
        FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 2. L01A001519    From 1 To 44 E-value: 5e-20 Score: 88.2
        FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 3. L02A000401    From 2 To 45 E-value: 6e-20 Score: 87.8
        FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 4. L11A004351    From 1 To 42 E-value: 1e-18 Score: 83.2
        QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 5. L13A025863    From 1 To 41 E-value: 6e-18 Score: 81.3
        GVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: