Record in detail


General Info

  • lamp_id:L01A001592
  • Name:Sequence 4 from patent US 5734015
  • FullName:Sequence 4 from patent US 5734015
  • Source:Synthetic
  • Mass:4486.2 Da
  • Sequence Length:37 aa
  • Isoelectric Point:12.26
  • Activity:Antimicrobial
  • Sequence
        GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002745    From 1 To 37 E-value: 2e-16 Score: 75.9
        GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • 2. L01A001592    From 1 To 37 E-value: 2e-16 Score: 75.9
        GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • 3. L01A001594    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        GFFKKAXRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • 4. L12A04329|    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYR
  • 5. L01A000394    From 1 To 37 E-value: 0.000000000000002 Score: 72.4
        GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: