Record in detail


General Info

  • lamp_id:L01A001593
  • Name:Sequence 3 from patent US 5734015
  • FullName:Sequence 3 from patent US 5734015
  • Source:Synthetic
  • Mass:3136.8 Da
  • Sequence Length:30 aa
  • Isoelectric Point:12.3
  • Activity:Antimicrobial
  • Sequence
        GXFKKAXRKVKNAGRRVLKGVGIHYGVGLI
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002746    From 1 To 30 E-value: 0.000000001 Score: 53.5
        GWFKKAWRKVKNAGRRVLKGVGIHYGVGLI
  • 2. L02A000692    From 1 To 30 E-value: 0.000000001 Score: 53.5
        GWFKKAWRKVKNAGRRVLKGVGIHYGVGLI
  • 3. L01A001593    From 1 To 30 E-value: 0.000000002 Score: 52.8
        GXFKKAXRKVKNAGRRVLKGVGIHYGVGLI
  • 4. L01A000395    From 1 To 29 E-value: 0.0000001 Score: 47
        GWFKKAWRKVKNAGR-VLKGVGIHYGVGLI
  • 5. L12A04329|    From 1 To 28 E-value: 0.0003 Score: 35.8
        GWFKKAWRKVKHAGRRVLDTAKGVGRHY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: