Record in detail


General Info

  • lamp_id:L01A001594
  • Name:Sequence 2 from patent US 5734015
  • FullName:Sequence 2 from patent US 5734015
  • Source:Synthetic
  • Mass:4357.1 Da
  • Sequence Length:37 aa
  • Isoelectric Point:12.26
  • Activity:Antimicrobial
  • Sequence
        GFFKKAXRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001594    From 1 To 37 E-value: 0.000000000000001 Score: 73.2
        GFFKKAXRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • 2. L01A002745    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • 3. L01A001592    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
  • 4. L12A04329|    From 1 To 37 E-value: 0.00000000000001 Score: 70.1
        GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYR
  • 5. L01A000394    From 1 To 37 E-value: 0.00000000000001 Score: 70.1
        GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: