Record in detail


General Info

  • lamp_id:L01A001761
  • Name:Sequence 12 from patent US 5607914
  • FullName:Sequence 12 from patent US 5607914
  • Source:Synthetic
  • Mass:3690.4 Da
  • Sequence Length:30 aa
  • Isoelectric Point:12.91
  • Activity:Antimicrobial
  • Sequence
        KLKKALRALARHWKGWLRRIGRRIERVGQH
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001761    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        KLKKALRALARHWKGWLRRIGRRIERVGQH
  • 2. L01A001764    From 2 To 31 E-value: 0.00001 Score: 40.4
        RIYRAIRHIPRRIRGWLRRIGRRIERVGQH
  • 3. L01A001765    From 5 To 20 E-value: 0.0006 Score: 34.7
        GWLRRIGRRIERVGQH
  • 4. L01A001762    From 1 To 16 E-value: 0.0006 Score: 34.7
        GWLRRIGRRIERVGQH
  • 5. L01A001762    From 17 To 30 E-value: 0.057 Score: 28.1
        KLKKALRALARHWK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: