Record in detail


General Info

  • lamp_id:L01A001767
  • Name:Sequence 6 from patent US 5607914
  • FullName:Sequence 6 from patent US 5607914
  • Source:Synthetic
  • Mass:4929.9 Da
  • Sequence Length:43 aa
  • Isoelectric Point:12.98
  • Activity:Antimicrobial
  • Sequence
        IRALQRAVRHPRAIRRIYRGWKKAIRAGPGVTIGIAHAKSQLW
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001767    From 1 To 43 E-value: 8e-19 Score: 84
        IRALQRAVRHPRAIRRIYRGWKKAIRAGPGVTIGIAHAKSQLW
  • 2. L01A001755    From 1 To 26 E-value: 0.00000001 Score: 50.4
        IRALQRAVRHPRAIRRIYRGWKKAIR
  • 3. L01A001768    From 10 To 40 E-value: 0.0000003 Score: 45.8
        KALRALARHWKRAL-AGPGVTIGIAHAKSQLW
  • 4. L01A001772    From 1 To 32 E-value: 0.000004 Score: 42
        KKIEKAIKHIPKKIKAGPGVTIGIAHAKSQLW
  • 5. L01A001771    From 4 To 31 E-value: 0.000004 Score: 42
        KALRALARHWK----AGPGVTIGIAHAKSQLW

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: