Record in detail


General Info

  • lamp_id:L01A001772
  • Name:Sequence 1 from patent US 5607914
  • FullName:Sequence 1 from patent US 5607914
  • Source:Synthetic
  • Mass:3490.3 Da
  • Sequence Length:32 aa
  • Isoelectric Point:11.28
  • Activity:Antimicrobial
  • Sequence
        KKIEKAIKHIPKKIKAGPGVTIGIAHAKSQLW
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001772    From 1 To 32 E-value: 0.000000000005 Score: 61.6
        KKIEKAIKHIPKKIKAGPGVTIGIAHAKSQLW
  • 2. L01A001771    From 1 To 31 E-value: 0.0000003 Score: 45.4
        KLKKALRALARHWKAGPGVTIGIAHAKSQLW
  • 3. L01A001767    From 12 To 43 E-value: 0.000004 Score: 42
        RAIRRIYRGWKKAIRAGPGVTIGIAHAKSQLW
  • 4. L01A001766    From 1 To 38 E-value: 0.000004 Score: 42
        KLIRKLIRWLRRKIRALQRAVAGPGVTIGIAHAKSQLW
  • 5. L01A001765    From 12 To 41 E-value: 0.000005 Score: 41.6
        RRIERVGQHL--RALAGPGVTIGIAHAKSQLW

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: