Record in detail


General Info

  • lamp_id:L01A001802
  • Name:DEFB1_CHILA
  • FullName:Beta-defensin 1
  • Source:Chinchilla lanigera
  • Mass:4132.9 Da
  • Sequence Length:36 aa
  • Isoelectric Point:10.82
  • Activity:Antibacterial, Antifungal
  • Sequence
        QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR
  • Function:Has antibacterial activity against Gram-positive bacterium S.pneumoniae Serotype 14. Is also active against Gram-negative bacteria M.catarrhalis 1857, and non-typeable H.influenzae strains 86-028NP and 1128. Has antifungal activity against C.albicans. May have a role in maintaining sterility in the middle ear.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000248    From 29 To 64 E-value: 0.000000000000001 Score: 73.6
        QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR
  • 2. L05A0DEF89    From 7 To 42 E-value: 0.000000000000003 Score: 72.4
        QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR
  • 3. L01A001802    From 1 To 36 E-value: 0.000000000000005 Score: 71.6
        QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR
  • 4. L01A003036    From 7 To 42 E-value: 0.000000000002 Score: 62.8
        QKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCR
  • 5. L01A002569    From 1 To 36 E-value: 0.000000000004 Score: 62
        QKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  S.pneumoniae  MIC:  5 μg/ml  (1.2098 μM)  
  •   2  Target:  M.catarrhalis  MIC:  5 μg/ml  (1.2098 μM)  
  •   3  Target:  C.ablicans  MIC:  12.5 μg/ml  (3.02451 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bakaletz L.O.,Munson R.S. Jr.,Bevins C.L.,Wilk D.,Harris R.H.,
  •   Title:Identification and characterization of mucosal antimicrobial peptides expressed by the chinchilla (Chinchilla lanigera) airway.
  •   Journal:J. Biol. Chem., 2004, 279, 20250-20256  [PubMed:14996845]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: