Record in detail


General Info

  • lamp_id:L01A001803
  • Name:odorranain-k1 antimicrobial peptide
  • FullName:odorranain-k1 antimicrobial peptide
  • Source:Odorrana grahami (Yunnanfu frog )
  • Mass:4248.3 Da
  • Sequence Length:39 aa
  • Isoelectric Point:12.15
  • Activity:Antibacterial, Antifungal
  • Sequence
        GLFTLIKGAAKLIGKTVPKKQARLGMNLWLVKLPTNVKT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001803    From 1 To 39 E-value: 2e-16 Score: 76.3
        GLFTLIKGAAKLIGKTVPKKQARLGMNLWLVKLPTNVKT
  • 2. L12A07336|    From 42 To 80 E-value: 0.00000000000003 Score: 69.3
        GLFTLIKGAAKLIGKTVAKEAGRLGLNLWLVKLPTNVKT
  • 3. L13A013192    From 1 To 39 E-value: 0.0000000000001 Score: 67
        GLFTLIKGAAKLIGKTVAKEAGRLGLNLWLVKLPTNVKT
  • 4. L12A07338|    From 42 To 78 E-value: 0.0000006 Score: 44.7
        GLFTLIKGAAKLIGKTVAKKAGKTGLELMACKITNQC
  • 5. L13A027645    From 1 To 37 E-value: 0.0000006 Score: 44.7
        GLFTLIKGAAKLIGKTVAKEAGRTGLELMACKITNQC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  4.68 μg/ml  (1.10162 μM)  
  •   2  Target:  S. aureus  MIC:  4.68 μg/ml  (1.10162 μM)  
  •   3  Target:  B. subtilis  MIC:  1.1 μg/ml  (0.258927 μM)  
  •   4  Target:  C.albicans  MIC:  1.1 μg/ml  (0.258927 μM)  
  •   5  Target:  E. coli  MIC:  4.67313 μg/ml  (1.1 μM)  
  •   6  Target:  S. aureus  MIC:  4.67313 μg/ml  (1.1 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: