Record in detail
General Info
- lamp_id:L01A001822
- Name:OdP2a
- FullName:OdP2a
- Source:Odorrana grahami (Yunnanfu frog )
- Mass:3912.5 Da
- Sequence Length:38 aa
- Isoelectric Point:8.52
- Activity:Antibacterial, Antifungal
- Sequence
GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKC - Function:
Cross-Linking
- Cross-linking
- 1 Database:APD 1304
- 2 Database:CAMP CAMPSQ710
- 3 Database:DBAASP 1507
- 4 Database:dbAMP dbAMP_03601
- 5 Database:DRAMP DRAMP01387
- 6 Database:SATPdb satpdb28586
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A001822 From 1 To 38 E-value: 8e-17 Score: 77.4
GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKC - 2. L12A07186| From 46 To 66 E-value: 0.000005 Score: 41.6
GLLSGILGAGKHIVCGLSGLC - 3. L13A014468 From 1 To 21 E-value: 0.00001 Score: 40.4
GLLSGILGAGKNIVCGLSGPC - 4. L12A07348| From 47 To 67 E-value: 0.00002 Score: 39.3
GLLSGILGAGKNIVCGLSGLC - 5. L01A003163 From 1 To 21 E-value: 0.00003 Score: 38.9
GLLSGILGAGKHIVCGLSGLC
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E. coli MIC: 6.25 μg/ml (1.59744 μM)
- 2 Target: S. aureus MIC: 3.12 μg/ml (0.797444 μM)
- 3 Target: B. subtilis MIC: 12.5 μg/ml (3.19489 μM)
- 4 Target: C. albicans MIC: 3.12 μg/ml (0.797444 μM)
- 5 Target: E. coli MIC: 6.26 μg/ml (1.6 μM)
- 6 Target: S. aureus MIC: 3.13 μg/ml (0.8 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database