Record in detail


General Info

  • lamp_id:L01A001838
  • Name:Sequence 3 from patent US 6790833
  • FullName:Sequence 3 from patent US 6790833
  • Source:Synthetic
  • Mass:4103.8 Da
  • Sequence Length:34 aa
  • Isoelectric Point:10.74
  • Activity:Antimicrobial
  • Sequence
        SPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_11201

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001836    From 18 To 51 E-value: 0.000000000000005 Score: 71.2
        SPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCR
  • 2. L01A001838    From 1 To 34 E-value: 0.000000000000007 Score: 71.2
        SPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCR
  • 3. L13A026775    From 18 To 50 E-value: 0.00000000000002 Score: 69.7
        SPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRC
  • 4. L01A001839    From 1 To 20 E-value: 0.000001 Score: 43.5
        LAHQKPFIRKSYKCLHKRCR
  • 5. L01A001840    From 1 To 16 E-value: 0.0004 Score: 35.4
        KPFIRKSYKCLHKRCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: