Record in detail


General Info

  • lamp_id:L01A001856
  • Name:Sequence 45 from patent US 6936432
  • FullName:Sequence 45 from patent US 6936432
  • Source:Synthetic
  • Mass:5434.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:12.15
  • Activity:Antimicrobial
  • Sequence
        LRLLTPSHFTRIGLTVAKKHVKRAHERNRIKRLTRELDFVVLTEAL
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001856    From 1 To 46 E-value: 1e-20 Score: 90.5
        LRLLTPSHFTRIGLTVAKKHVKRAHERNRIKRLTRELDFVVLTEAL
  • 2. L01A001857    From 1 To 46 E-value: 7e-20 Score: 87.4
        LRLLTPSHFTRIGLTVAKKNVKRAHERNRIKRLTRELDFVVLSEAL
  • 3. L01A001850    From 1 To 46 E-value: 5e-19 Score: 84.7
        LRLLTPSQFTRIGLTVAKKNVRRAHERNRIKRLTRELDFVVLSEAL
  • 4. L01A001855    From 1 To 46 E-value: 4e-18 Score: 82
        LRLLTPAHFTRIGLTVAKKNVRRAHERXRIKRLTRELDFVVLSEAL
  • 5. L01A001851    From 1 To 46 E-value: 7e-18 Score: 80.9
        LRLLTPKHFNRIGLTIAKKNVKRAHERNRIKRLARELDFVVLTEVL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: