Record in detail


General Info

  • lamp_id:L01A001864
  • Name:Sequence 53 from patent US 6936432
  • FullName:Sequence 53 from patent US 6936432
  • Source:Synthetic
  • Mass:6023 Da
  • Sequence Length:51 aa
  • Isoelectric Point:11.52
  • Activity:Antimicrobial
  • Sequence
        ERLRKRPDFLRVGFTATKKIGGAVERNRAKRRLREPLHDYVFLLDDVKTAL
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001864    From 1 To 51 E-value: 4e-24 Score: 101
        ERLRKRPDFLRVGFTATKKIGGAVERNRAKRRLREPLHDYVFLLDDVKTAL
  • 2. L01A001916    From 1 To 72 E-value: 0.000000000000001 Score: 73.9
        ERLRKRPDFLLAARVGFTATKKIGGAVERNRAKRRLREAARLVLPL-DYVFIARGGTGTREWARLLDDVKTAL
  • 3. L01A001873    From 2 To 45 E-value: 0.00000008 Score: 47.8
        RMRRSADFERVGLIIAKSVGSAVERHRVARRLRH-LHDHVVILEQ
  • 4. L01A001881    From 1 To 41 E-value: 0.0000002 Score: 46.6
        NRLKKNEDFQRVGLSVSKKIGNAVMRNRIKRLIRQ-LKDYII
  • 5. L01A001870    From 1 To 38 E-value: 0.0000005 Score: 45.1
        NRLRRREDFARAGFVVSKAVGGAVVRNQVKRRLRHLPL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: