Record in detail


General Info

  • lamp_id:L01A001867
  • Name:Sequence 57 from patent US 6936432
  • FullName:Sequence 57 from patent US 6936432
  • Source:Synthetic
  • Mass:5426.3 Da
  • Sequence Length:46 aa
  • Isoelectric Point:10.99
  • Activity:Antimicrobial
  • Sequence
        YRLLKTDDFSRIGLVVGKKTAKRANERNYMKRVIRDLDFVVARAEL
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001867    From 1 To 46 E-value: 4e-21 Score: 91.7
        YRLLKTDDFSRIGLVVGKKTAKRANERNYMKRVIRDLDFVVARAEL
  • 2. L01A001920    From 1 To 52 E-value: 0.00000000000001 Score: 70.5
        YRLLKTDDFSSVFRIGLVVGKKTAKRANERNYMKRVIRDWFRLNKNRLDFVV
  • 3. L01A001921    From 1 To 52 E-value: 0.00000000000003 Score: 68.9
        YRLLKTDDFSSVFRIGLVVGEKTAKRANERNYMKRVIRDWFRLNKNRLDFVV
  • 4. L01A001857    From 2 To 41 E-value: 0.000000002 Score: 52.8
        RLLTPSHFTRIGLTVAKKNVKRAHERNRIKRLTRELDFVV
  • 5. L01A001856    From 2 To 41 E-value: 0.000000002 Score: 52.8
        RLLTPSHFTRIGLTVAKKHVKRAHERNRIKRLTRELDFVV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: