Record in detail


General Info

  • lamp_id:L01A001868
  • Name:Sequence 59 from patent US 6936432
  • FullName:Sequence 59 from patent US 6936432
  • Source:Synthetic
  • Mass:5774.8 Da
  • Sequence Length:50 aa
  • Isoelectric Point:12.34
  • Activity:Antimicrobial
  • Sequence
        ARLHRPSEFARLGLVIAKRFAARAVTRNTLKRVIRELDYVVLKRSARAEV
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001868    From 1 To 50 E-value: 2e-22 Score: 95.9
        ARLHRPSEFARLGLVIAKRFAARAVTRNTLKRVIRELDYVVLKRSARAEV
  • 2. L01A001922    From 1 To 74 E-value: 6e-16 Score: 74.3
        ARLHRPSEFAAALRLGLVIAKRFAARAVTRNTLKRVIREAFRARRLALDYVVRLHSKLTPASLTALKRSARAEV
  • 3. L01A001861    From 2 To 44 E-value: 0.00000001 Score: 50.4
        RLLTPAQFKRLGLTVAKRYVKRANQRNRIKRVIRDIDIVVLNK
  • 4. L01A001867    From 2 To 46 E-value: 0.00000002 Score: 49.3
        RLLKTDDFSRIGLVVGKKTAKRANERNYMKRVIRDLDFVV----ARAEL
  • 5. L01A001856    From 2 To 42 E-value: 0.0000001 Score: 47
        RLLTPSHFTRIGLTVAKKHVKRAHERNRIKRLTRELDFVVL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: