Record in detail


General Info

  • lamp_id:L01A001871
  • Name:Sequence 62 from patent US 6936432
  • FullName:Sequence 62 from patent US 6936432
  • Source:Synthetic
  • Mass:5307.3 Da
  • Sequence Length:46 aa
  • Isoelectric Point:12.68
  • Activity:Antimicrobial
  • Sequence
        NRLRRREDFARAGFVVSKAVGVAVVRNKVKRRLRHLPLVVVLARDL
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001871    From 1 To 46 E-value: 3e-19 Score: 85.5
        NRLRRREDFARAGFVVSKAVGVAVVRNKVKRRLRHLPLVVVLARDL
  • 2. L01A001870    From 1 To 46 E-value: 3e-18 Score: 82
        NRLRRREDFARAGFVVSKAVGGAVVRNQVKRRLRHLPLVVVLARDL
  • 3. L01A001925    From 1 To 39 E-value: 0.000000000001 Score: 63.5
        NRLRRREDFATAVRAGFVVSKAVGVAVVRNKVKRRLRHL
  • 4. L01A001924    From 1 To 39 E-value: 0.00000000002 Score: 59.3
        NRLRRREDFATAVRAGFVVSKAVGGAVVRNQVKRRLKHL
  • 5. L01A001893    From 1 To 47 E-value: 0.000000002 Score: 53.1
        NRLRRREDFARIGIVVSKKVSKLAVTRNRFKRQLRALKQIVVLGDDL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: