Record in detail


General Info

  • lamp_id:L01A001878
  • Name:Sequence 70 from patent US 6936432
  • FullName:Sequence 70 from patent US 6936432
  • Source:Synthetic
  • Mass:6416.5 Da
  • Sequence Length:52 aa
  • Isoelectric Point:12.05
  • Activity:Antimicrobial
  • Sequence
        ERLYLRDEINTVFSMLVSVAKKRFRRAVKRNRVRRLVRELDVLLPDFRTVER
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001878    From 1 To 52 E-value: 4e-23 Score: 98.2
        ERLYLRDEINTVFSMLVSVAKKRFRRAVKRNRVRRLVRELDVLLPDFRTVER
  • 2. L01A001951    From 1 To 77 E-value: 5e-18 Score: 81.6
        ERLYLRDEINTVFSMLVSVAKKRFRRAVKRNRVRRLVREAYRLNKHLLDVLQERQIYATIAFMVVSDELPDFRTVER
  • 3. L01A001852    From 14 To 38 E-value: 0.0005 Score: 35
        LTVAKKHLKRAHERNRIKRLVRELD
  • 4. L01A001904    From 8 To 39 E-value: 0.0007 Score: 34.7
        QFKNVFRLGLTVAKKHLKRAHERNRIKRLVRE
  • 5. L01A001903    From 2 To 39 E-value: 0.001 Score: 33.5
        RLLTPKHFNFVFRIGLTIAKKNVKRAHERNRIKRLARE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: