Record in detail


General Info

  • lamp_id:L01A001882
  • Name:Sequence 74 from patent US 6936432
  • FullName:Sequence 74 from patent US 6936432
  • Source:Synthetic
  • Mass:5197.1 Da
  • Sequence Length:45 aa
  • Isoelectric Point:12.17
  • Activity:Antimicrobial
  • Sequence
        HRIKRSDEFSRVLSVSKKIGNAVTRNRVKRLIRTISDYVIVKGSL
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001882    From 1 To 45 E-value: 1e-19 Score: 86.7
        HRIKRSDEFSRVLSVSKKIGNAVTRNRVKRLIRTISDYVIVKGSL
  • 2. L01A001883    From 1 To 46 E-value: 0.0000000000003 Score: 65.9
        HRIKKNDEFQRIGLSVSKKIGNAVVRNRIKRMIRQIDDFVILKKSL
  • 3. L01A001881    From 1 To 46 E-value: 0.00000000001 Score: 60.1
        NRLKKNEDFQRVGLSVSKKIGNAVMRNRIKRLIRQLKDYIITKKSL
  • 4. L01A001932    From 1 To 51 E-value: 0.00000000002 Score: 59.7
        HRIKKNDEFSRVFRVLSVSKKIGNAVTRNRVKRLIRTSITELKDEIDYVII
  • 5. L01A001889    From 2 To 46 E-value: 0.000000008 Score: 50.8
        RVKREKDFKRVGLSVSKKLGNAVTRNQIKRRIRHLVDFVVMEKNL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: