Record in detail


General Info

  • lamp_id:L01A001885
  • Name:Sequence 77 from patent US 6936432
  • FullName:Sequence 77 from patent US 6936432
  • Source:Synthetic
  • Mass:5531.5 Da
  • Sequence Length:47 aa
  • Isoelectric Point:11.98
  • Activity:Antimicrobial
  • Sequence
        HHLRDRKVFARAAVSISKTKYKLAVERNLIRRQVKALNDVLVKQTIF
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001885    From 1 To 47 E-value: 2e-21 Score: 92.8
        HHLRDRKVFARAAVSISKTKYKLAVERNLIRRQVKALNDVLVKQTIF
  • 2. L01A001886    From 1 To 47 E-value: 0.000000000000005 Score: 71.6
        HSLRERKVFTRVAISIAKTKYKLAVQRNLIKRQIRSLEDILVKQKLF
  • 3. L01A001935    From 1 To 40 E-value: 0.0000000000002 Score: 66.2
        HHLRERKVFAALLRAAVSISKTKYKLAVERNLIRRQVKAI
  • 4. L01A001936    From 1 To 40 E-value: 0.00000006 Score: 48.1
        HSLRREKVFTTILRVAISIAKTKYKLAVQRNLIKRQIRSV
  • 5. L01A001893    From 1 To 42 E-value: 0.0003 Score: 35.8
        NRLRRREDFARIGIVVSKKVSKLAVTRNRFKRQLRALKQIVV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: