Record in detail


General Info

  • lamp_id:L01A001888
  • Name:Sequence 80 from patent US 6936432
  • FullName:Sequence 80 from patent US 6936432
  • Source:Synthetic
  • Mass:5311.3 Da
  • Sequence Length:46 aa
  • Isoelectric Point:12
  • Activity:Antimicrobial
  • Sequence
        YRVKSDKDFQRVGLSVGKRLGNAVVRNAIKRKLRHLGDFVVMKKNL
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001888    From 1 To 46 E-value: 1e-20 Score: 90.5
        YRVKSDKDFQRVGLSVGKRLGNAVVRNAIKRKLRHLGDFVVMKKNL
  • 2. L01A001889    From 1 To 46 E-value: 0.000000000000007 Score: 70.9
        FRVKREKDFKRVGLSVSKKLGNAVTRNQIKRRIRHLVDFVVMEKNL
  • 3. L01A001887    From 1 To 44 E-value: 0.00000000000001 Score: 70.1
        VKREKDFQRVGISVGKKIGNAVTRNAVKRKIRHLKDFVVLQQNL
  • 4. L01A001938    From 1 To 54 E-value: 0.000000000002 Score: 62.4
        YRVKREKDFQAIFRVGLSVGKRLGNAVVRNAIKRKLRHIIQNAKGSLDFVVIAR
  • 5. L01A001883    From 1 To 46 E-value: 0.000000000007 Score: 60.8
        HRIKKNDEFQRIGLSVSKKIGNAVVRNRIKRMIRQIDDFVILKKSL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: