Record in detail


General Info

  • lamp_id:L01A001895
  • Name:Sequence 88 from patent US 6936432
  • FullName:Sequence 88 from patent US 6936432
  • Source:Synthetic
  • Mass:5388.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:12.27
  • Activity:Antimicrobial
  • Sequence
        ERLRGSCRVRRFLATFRRGYGKAVARNRARRLSKELVDLVLLLCVL
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001895    From 1 To 46 E-value: 1e-19 Score: 86.7
        ERLRGSCRVRRFLATFRRGYGKAVARNRARRLSKELVDLVLLLCVL
  • 2. L01A001946    From 1 To 38 E-value: 0.000000000002 Score: 62.8
        ERLRGSCRVRAVFRFLATFRRGYGKAVARNRARRLSKE
  • 3. L01A001894    From 3 To 46 E-value: 0.00003 Score: 39.3
        LKSKIEIQRILVTFSKGFRGSVKRNRIRRLFKELEDIIFIESLM
  • 4. L01A001945    From 11 To 54 E-value: 0.014 Score: 30
        KIFRILVTFSKGFRGSVKRNRIRRLFKEAFRKRLELLDIIFVVS
  • 5. L01A001891    From 3 To 43 E-value: 0.066 Score: 27.7
        LKKDSDFRRVGISVSKKVGKAITRNRVRRLIKEKIKDIVFI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: