Record in detail


General Info

  • lamp_id:L01A001909
  • Name:Sequence 68 from patent US 7001924
  • FullName:Sequence 68 from patent US 7001924
  • Source:Synthetic
  • Mass:8340.6 Da
  • Sequence Length:71 aa
  • Isoelectric Point:11.93
  • Activity:Antimicrobial
  • Sequence
        LRLLTPSHFTFVFRIGLTVAKKNVKRAHERNRIKRLTRESFRLRQHELDFVVVAKRGVADLDNRALSEALE
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001909    From 1 To 71 E-value: 1e-35 Score: 140
        LRLLTPSHFTFVFRIGLTVAKKNVKRAHERNRIKRLTRESFRLRQHELDFVVVAKRGVADLDNRALSEALE
  • 2. L01A001902    From 1 To 71 E-value: 2e-34 Score: 135
        LRLLTPSQFTFVFRIGLTVAKKNVRRAHERNRIKRLTRESFRLRQHELDFVVVAKKGVADLDNRALSEALE
  • 3. L01A001907    From 1 To 71 E-value: 7e-34 Score: 134
        LRLLTPAHFTFVFRIGLTVAKKNVRRAHERXRIKRLTRESFRLRQHELDFVVVAKKGVADLDNRALSEALE
  • 4. L01A001908    From 1 To 71 E-value: 3e-32 Score: 128
        LRLLTPSHFTFVFRIGLTVAKKHVKRAHERNRIKRLTRESFRLHQHALDFVVLVKKGVADLDNRALTEALE
  • 5. L01A001903    From 1 To 70 E-value: 1e-27 Score: 113
        LRLLTPKHFNFVFRIGLTIAKKNVKRAHERNRIKRLAREYFRLHQHQLDFVVLVRKGVAELDNHQLTEVL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: