Record in detail


General Info

  • lamp_id:L01A001911
  • Name:Sequence 70 from patent US 7001924
  • FullName:Sequence 70 from patent US 7001924
  • Source:Synthetic
  • Mass:8321.7 Da
  • Sequence Length:71 aa
  • Isoelectric Point:11.14
  • Activity:Antimicrobial
  • Sequence
        LRLLTPEHYQKVFRLGLAVPKKQIKTAVGRNRFKRICRESFRLHQNQLDFVVIAKKSAQDLSNEELFNLLG
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001911    From 1 To 71 E-value: 3e-37 Score: 145
        LRLLTPEHYQKVFRLGLAVPKKQIKTAVGRNRFKRICRESFRLHQNQLDFVVIAKKSAQDLSNEELFNLLG
  • 2. L01A001903    From 1 To 71 E-value: 5e-19 Score: 84.7
        LRLLTPKHFNFVFRIGLTIAKKNVKRAHERNRIKRLAREYFRLHQHQLDFVVLVRKGVAELDNHQLTEVLG
  • 3. L01A001908    From 1 To 66 E-value: 7e-19 Score: 84.3
        LRLLTPSHFTFVFRIGLTVAKKHVKRAHERNRIKRLTRESFRLHQHALDFVVLVKKGVADLDNRAL
  • 4. L01A001909    From 1 To 66 E-value: 2e-18 Score: 82.8
        LRLLTPSHFTFVFRIGLTVAKKNVKRAHERNRIKRLTRESFRLRQHELDFVVVAKRGVADLDNRAL
  • 5. L01A001907    From 1 To 66 E-value: 2e-17 Score: 79.3
        LRLLTPAHFTFVFRIGLTVAKKNVRRAHERXRIKRLTRESFRLRQHELDFVVVAKKGVADLDNRAL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: