Record in detail


General Info

  • lamp_id:L01A001917
  • Name:Sequence 76 from patent US 7001924
  • FullName:Sequence 76 from patent US 7001924
  • Source:Synthetic
  • Mass:8619.1 Da
  • Sequence Length:74 aa
  • Isoelectric Point:10.59
  • Activity:Antimicrobial
  • Sequence
        DSLKNKSEFDRVYKLGLSVSKKVGNAVKRNLIKRRLRSLTLKHAALCALVFVPRSDCYHLDFWALEKHFLEMLT
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001917    From 1 To 74 E-value: 6e-39 Score: 150
        DSLKNKSEFDRVYKLGLSVSKKVGNAVKRNLIKRRLRSLTLKHAALCALVFVPRSDCYHLDFWALEKHFLEMLT
  • 2. L01A001918    From 1 To 74 E-value: 2e-37 Score: 146
        DSLKNKSEFDRVYKLGLSVSKKVGNAVKRNLIKRRLRSLVTRHAALCALVFVPRSDCYHLDFWALEKHFLEMLT
  • 3. L01A001865    From 1 To 50 E-value: 0.000000000000007 Score: 71.2
        DSLKNKSEFD---KLGLSVSKKVGNAVKRNLIKRRLRSCQ-------ALVF-------------LEKHFLEML
  • 4. L01A001923    From 1 To 69 E-value: 0.000000003 Score: 52.4
        DRLRQKVAIQRTLRLGLAVSRKVGNAVVRNRIKRRLREAFRQQSVRTDVLVVARPSARQLSMRAMGAYL
  • 5. L01A001937    From 1 To 67 E-value: 0.000000003 Score: 52
        VKSDKDFQAIFRVGISVGKKIGNAVTRNAVKRKIRHVLMELGPYLDFVVIARKGVEELDYSELQQNL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: