Record in detail


General Info

  • lamp_id:L01A001921
  • Name:Sequence 80 from patent US 7001924
  • FullName:Sequence 80 from patent US 7001924
  • Source:Synthetic
  • Mass:8560.9 Da
  • Sequence Length:71 aa
  • Isoelectric Point:11.89
  • Activity:Antimicrobial
  • Sequence
        YRLLKTDDFSSVFRIGLVVGEKTAKRANERNYMKRVIRDWFRLNKNRLDFVVRVRRKFDRATAKQARAELA
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001921    From 1 To 71 E-value: 1e-35 Score: 139
        YRLLKTDDFSSVFRIGLVVGEKTAKRANERNYMKRVIRDWFRLNKNRLDFVVRVRRKFDRATAKQARAELA
  • 2. L01A001920    From 1 To 71 E-value: 5e-35 Score: 137
        YRLLKTDDFSSVFRIGLVVGKKTAKRANERNYMKRVIRDWFRLNKNRLDFVVRVRRKFDRATAKQARAELA
  • 3. L01A001867    From 1 To 41 E-value: 0.00000000000003 Score: 68.9
        YRLLKTDDFS---RIGLVVGKKTAKRANERNYMKRVIRD--------LDFVV
  • 4. L01A001903    From 2 To 56 E-value: 0.000000000001 Score: 63.5
        RLLTPKHFNFVFRIGLTIAKKNVKRAHERNRIKRLAREYFRLHQHQLDFVVLVRK
  • 5. L01A001913    From 2 To 55 E-value: 0.000000000001 Score: 63.5
        RLLTPAQFKSVFRLGLTVAKRYVKRANQRNRIKRVIRDSFRLNQHNIDIVVLVR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: