Record in detail


General Info

  • lamp_id:L01A001922
  • Name:Sequence 81 from patent US 7001924
  • FullName:Sequence 81 from patent US 7001924
  • Source:Synthetic
  • Mass:8463.9 Da
  • Sequence Length:75 aa
  • Isoelectric Point:12.51
  • Activity:Antimicrobial
  • Sequence
        ARLHRPSEFAAALRLGLVIAKRFAARAVTRNTLKRVIREAFRARRLALDYVVRLHSKLTPASLTALKRSARAEVD
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001922    From 1 To 75 E-value: 8e-36 Score: 140
        ARLHRPSEFAAALRLGLVIAKRFAARAVTRNTLKRVIREAFRARRLALDYVVRLHSKLTPASLTALKRSARAEVD
  • 2. L01A001868    From 1 To 50 E-value: 6e-16 Score: 74.3
        ARLHRPSEFA---RLGLVIAKRFAARAVTRNTLKRVIRE--------LDYVV-------------LKRSARAEV
  • 3. L01A001920    From 2 To 70 E-value: 0.0000000002 Score: 56.2
        RLLKTDDFSSVFRIGLVVGKKTAKRANERNYMKRVIRDWFRLNKNRLDFVVRVRRKFDRATA----KQARAEL
  • 4. L01A001921    From 2 To 70 E-value: 0.0000000006 Score: 54.7
        RLLKTDDFSSVFRIGLVVGEKTAKRANERNYMKRVIRDWFRLNKNRLDFVVRVRRKFDRATA----KQARAEL
  • 5. L01A001913    From 2 To 69 E-value: 0.000000002 Score: 52.8
        RLLTPAQFKSVFRLGLTVAKRYVKRANQRNRIKRVIRDSFRLNQHNIDIVVLVRNGVMEMENAELNGL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: