Record in detail


General Info

  • lamp_id:L01A001923
  • Name:Sequence 82 from patent US 7001924
  • FullName:Sequence 82 from patent US 7001924
  • Source:Synthetic
  • Mass:8085.5 Da
  • Sequence Length:70 aa
  • Isoelectric Point:12.8
  • Activity:Antimicrobial
  • Sequence
        DRLRQKVAIQRTLRLGLAVSRKVGNAVVRNRIKRRLREAFRQQSVRTDVLVVARPSARQLSMRAMGAYLQ
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001923    From 1 To 70 E-value: 1e-33 Score: 133
        DRLRQKVAIQRTLRLGLAVSRKVGNAVVRNRIKRRLREAFRQQSVRTDVLVVARPSARQLSMRAMGAYLQ
  • 2. L01A001869    From 1 To 45 E-value: 0.0000000000005 Score: 65.1
        DRLRQKVAIQR---LGLAVSRKVGNAVVRNRIKRRLRE--------TDVLV-------------MGAYL
  • 3. L01A001940    From 2 To 61 E-value: 0.000000000007 Score: 60.8
        RIKKNADFQRIYRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHIDIIVIARQPAKDMT
  • 4. L01A001941    From 2 To 62 E-value: 0.00000000005 Score: 58.2
        RIKKDSDFQRIYRLGISVSKKLGNAVLRNKIKRAIREAYRLNIDEKIDIIVIARVSSKDID
  • 5. L01A001933    From 1 To 60 E-value: 0.0000000003 Score: 55.8
        HRIKKNFEFQTVFRIGLSVSKKIGNAVVRNRIKRMIRQILKQNISEIDFVILVRKSVLEL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: