Record in detail


General Info

  • lamp_id:L01A001932
  • Name:Sequence 93 from patent US 7001924
  • FullName:Sequence 93 from patent US 7001924
  • Source:Synthetic
  • Mass:8135.5 Da
  • Sequence Length:69 aa
  • Isoelectric Point:10.83
  • Activity:Antimicrobial
  • Sequence
        HRIKKNDEFSRVFRVLSVSKKIGNAVTRNRVKRLIRTSITELKDEIDYVIIARKPCAEMTYEQVKGSLW
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001932    From 1 To 69 E-value: 5e-36 Score: 141
        HRIKKNDEFSRVFRVLSVSKKIGNAVTRNRVKRLIRTSITELKDEIDYVIIARKPCAEMTYEQVKGSLW
  • 2. L01A001931    From 1 To 69 E-value: 2e-20 Score: 89.4
        NRLKRSDDFRKVFRVGLSVSKKIGNAVMRNRIKRLIRQFFQEHEQALDYIIIARKPAADMTYEETKKSL
  • 3. L01A001933    From 1 To 69 E-value: 2e-17 Score: 79.3
        HRIKKNFEFQTVFRIGLSVSKKIGNAVVRNRIKRMIRQILKQNISEIDFVILVRKSVLELKYAELKKSL
  • 4. L01A001940    From 1 To 69 E-value: 0.000000000000004 Score: 71.6
        YRIKKNADFQRIYRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHIDIIVIARQPAKDMTTLQIQNSL
  • 5. L01A001939    From 2 To 70 E-value: 0.00000000000001 Score: 70.5
        RVKKNADFKAIFRVGLSVSKKLGNAVTRNQIKRRIRHNFKVHKSHLDFVVIARQPAKDMTTLEMEKNLL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: