Record in detail


General Info

  • lamp_id:L01A001941
  • Name:Sequence 102 from patent US 7001924
  • FullName:Sequence 102 from patent US 7001924
  • Source:Synthetic
  • Mass:8217.5 Da
  • Sequence Length:70 aa
  • Isoelectric Point:10.78
  • Activity:Antimicrobial
  • Sequence
        YRIKKDSDFQRIYRLGISVSKKLGNAVLRNKIKRAIREAYRLNIDEKIDIIVIARVSSKDIDKQIQNSLE
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001941    From 1 To 70 E-value: 2e-33 Score: 132
        YRIKKDSDFQRIYRLGISVSKKLGNAVLRNKIKRAIREAYRLNIDEKIDIIVIARVSSKDIDKQIQNSLE
  • 2. L01A001940    From 1 To 70 E-value: 1e-22 Score: 96.7
        YRIKKNADFQRIYRLGISVSKKLGNAVLRNKIKRAIRENFKVH-KSHIDIIVIARQPAKDMTTLQIQNSLE
  • 3. L01A001939    From 1 To 60 E-value: 0.00000000000002 Score: 69.3
        FRVKKNADFKAIFRVGLSVSKKLGNAVTRNQIKRRIRHNFKVH-KSHLDFVVIARQPAKDM
  • 4. L01A001933    From 1 To 56 E-value: 0.0000000000006 Score: 64.7
        HRIKKNFEFQTVFRIGLSVSKKIGNAVVRNRIKRMIRQILKQNISE-IDFVILVRKS
  • 5. L01A001890    From 1 To 42 E-value: 0.000000000003 Score: 62.4
        YRIKKNADFQR---LGISVSKKLGNAVLRNKIKRAIREI--------LDIIVI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: