Record in detail


General Info

  • lamp_id:L01A001942
  • Name:Sequence 103 from patent US 7001924
  • FullName:Sequence 103 from patent US 7001924
  • Source:Synthetic
  • Mass:7885.3 Da
  • Sequence Length:70 aa
  • Isoelectric Point:11.27
  • Activity:Antimicrobial
  • Sequence
        KGLKNSEDFRKVYRVGISVSKKVGKAITRNRVRRLIKEVVIAMKDQIDIVFVRAIPPAATASYESIKNLV
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001942    From 1 To 70 E-value: 8e-35 Score: 137
        KGLKNSEDFRKVYRVGISVSKKVGKAITRNRVRRLIKEVVIAMKDQIDIVFVRAIPPAATASYESIKNLV
  • 2. L01A001931    From 3 To 66 E-value: 0.0000000000001 Score: 67
        LKRSDDFRKVFRVGLSVSKKIGNAVMRNRIKRLIRQFFQEHEQALDYIII-ARKPAADMTYEETK
  • 3. L01A001932    From 3 To 65 E-value: 0.000000000004 Score: 61.6
        IKKNDEFSRVFRV-LSVSKKIGNAVTRNRVKRLIRTSITELKDEIDYVII-ARKPCAEMTYEQVK
  • 4. L01A001891    From 1 To 46 E-value: 0.00000000004 Score: 58.5
        KGLKKDSDFR---RVGISVSKKVGKAITRNRVRRLIKEKI------KDIVFIKNL
  • 5. L01A001940    From 3 To 67 E-value: 0.0000000003 Score: 55.5
        IKKNADFQRIYRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHIDIIVI-ARQPAKDMTTLQIQN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: