Record in detail


General Info

  • lamp_id:L01A001945
  • Name:Sequence 106 from patent US 7001924
  • FullName:Sequence 106 from patent US 7001924
  • Source:Synthetic
  • Mass:8371 Da
  • Sequence Length:70 aa
  • Isoelectric Point:11.69
  • Activity:Antimicrobial
  • Sequence
        ISLKSKIEIQKIFRILVTFSKGFRGSVKRNRIRRLFKEAFRKRLELLDIIFVVSYGKLTLTYFSIESLMK
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001945    From 1 To 70 E-value: 2e-33 Score: 132
        ISLKSKIEIQKIFRILVTFSKGFRGSVKRNRIRRLFKEAFRKRLELLDIIFVVSYGKLTLTYFSIESLMK
  • 2. L01A001894    From 1 To 44 E-value: 0.0000000000004 Score: 65.1
        ISLKSKIEIQ---RILVTFSKGFRGSVKRNRIRRLFK-------ELEDIIFIES
  • 3. L01A001951    From 8 To 51 E-value: 0.000002 Score: 42.7
        EINTVFSMLVSVAKKRFRRAVKRNRVRRLVREAYRLNKHLLDVL
  • 4. L01A001946    From 3 To 41 E-value: 0.000005 Score: 41.6
        LRGSCRVRAVFRFLATFRRGYGKAVARNRARRLSKEAYR
  • 5. L01A001942    From 2 To 70 E-value: 0.000009 Score: 40.8
        GLKNSEDFRKVYRVGISVSKKVGKAITRNRVRRLIKEVVIAMKDQIDIVFVRAIPPAATASYESIKNLV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: