Record in detail


General Info

  • lamp_id:L01A001946
  • Name:Sequence 107 from patent US 7001924
  • FullName:Sequence 107 from patent US 7001924
  • Source:Synthetic
  • Mass:8118.5 Da
  • Sequence Length:71 aa
  • Isoelectric Point:11.61
  • Activity:Antimicrobial
  • Sequence
        ERLRGSCRVRAVFRFLATFRRGYGKAVARNRARRLSKEAYRALKSSLDLVLLVSVVEDSLAAYQRLLCVLC
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001946    From 1 To 71 E-value: 5e-34 Score: 134
        ERLRGSCRVRAVFRFLATFRRGYGKAVARNRARRLSKEAYRALKSSLDLVLLVSVVEDSLAAYQRLLCVLC
  • 2. L01A001895    From 1 To 35 E-value: 0.000000000002 Score: 63.2
        ERLRGSCRVR---RFLATFRRGYGKAVARNRARRLSKE
  • 3. L01A001945    From 3 To 63 E-value: 0.0000001 Score: 47
        LKSKIEIQKIFRILVTFSKGFRGSVKRNRIRRLFKEAFRKRLELLDIIFVVSYGKLTLTYF
  • 4. L01A001942    From 3 To 66 E-value: 0.000001 Score: 43.9
        LKNSEDFRKVYRVGISVSKKVGKAITRNRVRRLIKEVVIAMKDQIDIVFVRAIPPAATASYESI
  • 5. L01A001933    From 1 To 70 E-value: 0.0009 Score: 34.3
        HRIKKNFEFQTVFRIGLSVSKKIGNAVVRNRIKRMIRQILKQNISEIDFVILVRKSVLELKYAELKKSLI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: